PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00023050-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 102aa    MW: 11705 Da    PI: 10.3498
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00023050-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.24.4e-28959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krie+k+ rqvtfskR+ g++KKA EL vLCd+eva++ifs +g+lye+ss
  WALNUT_00023050-RA  9 KRIEDKTSRQVTFSKRKGGLMKKARELAVLCDVEVALMIFSDRGRLYEFSS 59
                        79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.427161IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-37160IPR002100Transcription factor, MADS-box
CDDcd002657.18E-36259No hitNo description
SuperFamilySSF554551.57E-28268IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MGRGKVQMKR IEDKTSRQVT FSKRKGGLMK KARELAVLCD VEVALMIFSD RGRLYEFSSA  60
ERLVFLELSH TLPFKRNDFL IFELILAFKS VVSVLCSCFP VP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S5e-20161161Myocyte-specific enhancer factor 2B
1tqe_R5e-20161161Myocyte-specific enhancer factor 2B
1tqe_Q5e-20161161Myocyte-specific enhancer factor 2B
1tqe_P5e-20161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ8290743e-96JQ829074.1 Carya cathayensis flowering locus C-like protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007043954.11e-29Flowering locus C, putative isoform 1
SwissprotQ8RU312e-26MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLI6QQB83e-36I6QQB8_9R
STRINGSolyc05g015730.1.11e-26(Solanum lycopersicum)
STRINGPOPTR_0004s11450.12e-26(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.34e-27MIKC_MADS family protein